(data stored in ACNUC7421 zone)

EMBL: AP011115.PE363

AP011115.PE363       Location/Qualifiers
FT   CDS             370305..371009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48610"
FT                   /db_xref="GOA:C1ARD3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD3"
FT                   /protein_id="BAH48610.1"
FT                   /translation="MTSSNYSAPPNDGSRHRTGPADALKGELPVTDSVLSYTDHGRTDE
FT                   MTLIPDRSPIVIGRSAYADLSLPTDPDISRLHATIERIGIHWTITDDGLSRNGTFVNGT
FT                   RLQGRQTLHPGDVIQVGESLLTYHGEPGTDCGITHIGDTVDPDIVLTPAQHTVLTELCR
FT                   PFHDGTDHPIPASNRQIADALHLSTETVKTHLRALFSTFHIEDLPQNQKRSRLVTLALT
FT                   NGVLDAAAPSDF"
     MTSSNYSAPP NDGSRHRTGP ADALKGELPV TDSVLSYTDH GRTDEMTLIP DRSPIVIGRS        60
     AYADLSLPTD PDISRLHATI ERIGIHWTIT DDGLSRNGTF VNGTRLQGRQ TLHPGDVIQV       120
     GESLLTYHGE PGTDCGITHI GDTVDPDIVL TPAQHTVLTE LCRPFHDGTD HPIPASNRQI       180
     ADALHLSTET VKTHLRALFS TFHIEDLPQN QKRSRLVTLA LTNGVLDAAA PSDF             234
//

If you have problems or comments...

PBIL Back to PBIL home page