(data stored in ACNUC7421 zone)

EMBL: AP011115.PE364

AP011115.PE364       Location/Qualifiers
FT   CDS             371130..371561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03640"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48611"
FT                   /db_xref="GOA:C1ARD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD4"
FT                   /protein_id="BAH48611.1"
FT                   /translation="MDPTFVIVGGATGALTAYVLPLWLIRSGRGPRLAAKREVSTAIDT
FT                   GALPPDADIWSWRPRLVESRQTVARGRWVMLAAGLLMSFVTLAHAVGEGGTLLTWVFVG
FT                   SAALSLVGAFGMHRQVRRADSLLAAISAGPTARPNFGAR"
     MDPTFVIVGG ATGALTAYVL PLWLIRSGRG PRLAAKREVS TAIDTGALPP DADIWSWRPR        60
     LVESRQTVAR GRWVMLAAGL LMSFVTLAHA VGEGGTLLTW VFVGSAALSL VGAFGMHRQV       120
     RRADSLLAAI SAGPTARPNF GAR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page