(data stored in ACNUC7421 zone)

EMBL: AP011115.PE365

AP011115.PE365       Location/Qualifiers
FT   CDS             371680..372369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48612"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD5"
FT                   /protein_id="BAH48612.1"
FT                   /translation="MRRVVRAFWGPRPEPVEALAGRWRLTLERVSQLLPVGGEWRQVHA
FT                   SEPDTACAPDELTAVLLVAQDTEAWSDRTGTGLRLVCTGEAGWAVELSGVAGGTPQFLL
FT                   QSLVMTVEAPEDAVVPESELLAMLAAVWEPDFGDVTDDDILDALEDDAGFVVGDPVVGR
FT                   FGYLCSARAVLIPDGLEASGPAVPDGGVLLHIAASGEIDTVVRVYERLRDAGALAPLAR
FT                   PLDRPTL"
     MRRVVRAFWG PRPEPVEALA GRWRLTLERV SQLLPVGGEW RQVHASEPDT ACAPDELTAV        60
     LLVAQDTEAW SDRTGTGLRL VCTGEAGWAV ELSGVAGGTP QFLLQSLVMT VEAPEDAVVP       120
     ESELLAMLAA VWEPDFGDVT DDDILDALED DAGFVVGDPV VGRFGYLCSA RAVLIPDGLE       180
     ASGPAVPDGG VLLHIAASGE IDTVVRVYER LRDAGALAPL ARPLDRPTL                   229
//

If you have problems or comments...

PBIL Back to PBIL home page