(data stored in ACNUC7421 zone)

EMBL: AP011115.PE366

AP011115.PE366       Location/Qualifiers
FT   CDS             complement(372400..374430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48613"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD6"
FT                   /protein_id="BAH48613.1"
FT                   /translation="MEFPMLSKGQNLSLPADVEQIDVVLGWTESDVEVDASALLLNVDG
FT                   KVRSDADFVFYNQPESTDGSVRFLGASGTEEGAQARIAIDLSTVPEDVHTVALGGSVAA
FT                   GGFGDLGKLALRVVDGAGHTLAEYVTADATTESAFVFGEVYRRNGDWKVRAVGQGWESG
FT                   LAGLATDFGVDIADDPDPELTESADAPSDRENSDGAVPTGSTGDAPQLVPELPTTPAAP
FT                   RKTATRGVRTTKRVVKKSKPLVFGLAEQDTWQPARLFSVIGVGAGEEQERRATSALIAT
FT                   MQAVRPFARAVCARVGAPAGTFEGYVEVAYARGETKVIPDAVLKVARGSRVWTGLLEVK
FT                   TGSGKLKKEQLENYLDVARKKKYDVVVSLSNDVPASAGELPVEVDRRKLAKVALRHLSW
FT                   AEVAHEARMLLSHGGIDDDLQSWVLAEFLRYLDHPRSGAVEFVDMGRHWVTVRDAVTAG
FT                   TLRAGDEKALTVADTWVSLSRHLALRLTAELGVTVKHVLPRRHSTDPAARNAAVAERLA
FT                   GDGVFEAVLRIPETAGDLVVIADVRTNKIRCRTTVEAPNEGTSGRRVSWLLKQLRDVPG
FT                   DVQVEAVFSERGNEACEHIEAVRVDPKVLTVGRSGDIVSFCLEQSFPMGGRRSGTAASF
FT                   ISSVTSSADGFYGTVVQQLREWVPAAPKQTEQPRAAAPEGE"
     MEFPMLSKGQ NLSLPADVEQ IDVVLGWTES DVEVDASALL LNVDGKVRSD ADFVFYNQPE        60
     STDGSVRFLG ASGTEEGAQA RIAIDLSTVP EDVHTVALGG SVAAGGFGDL GKLALRVVDG       120
     AGHTLAEYVT ADATTESAFV FGEVYRRNGD WKVRAVGQGW ESGLAGLATD FGVDIADDPD       180
     PELTESADAP SDRENSDGAV PTGSTGDAPQ LVPELPTTPA APRKTATRGV RTTKRVVKKS       240
     KPLVFGLAEQ DTWQPARLFS VIGVGAGEEQ ERRATSALIA TMQAVRPFAR AVCARVGAPA       300
     GTFEGYVEVA YARGETKVIP DAVLKVARGS RVWTGLLEVK TGSGKLKKEQ LENYLDVARK       360
     KKYDVVVSLS NDVPASAGEL PVEVDRRKLA KVALRHLSWA EVAHEARMLL SHGGIDDDLQ       420
     SWVLAEFLRY LDHPRSGAVE FVDMGRHWVT VRDAVTAGTL RAGDEKALTV ADTWVSLSRH       480
     LALRLTAELG VTVKHVLPRR HSTDPAARNA AVAERLAGDG VFEAVLRIPE TAGDLVVIAD       540
     VRTNKIRCRT TVEAPNEGTS GRRVSWLLKQ LRDVPGDVQV EAVFSERGNE ACEHIEAVRV       600
     DPKVLTVGRS GDIVSFCLEQ SFPMGGRRSG TAASFISSVT SSADGFYGTV VQQLREWVPA       660
     APKQTEQPRA AAPEGE                                                       676
//

If you have problems or comments...

PBIL Back to PBIL home page