(data stored in ACNUC7421 zone)

EMBL: AP011115.PE368

AP011115.PE368       Location/Qualifiers
FT   CDS             377542..381390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48615"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD8"
FT                   /protein_id="BAH48615.1"
FT                   /translation="MQLEKRFEAMGRPSPRMVRPDCSSKRPHGGVTMNSDKHLKHLGEL
FT                   AVAVGIGLAVAPAGTAVAAPSVGDSSTSSSSDSSDQTSSDGRAADRSTDGASSDRTSSG
FT                   TSRTDSDSSSDGSRSSTTGDSTTDSQSTSGTDSQSTSGTDTQSTTDTESTSATSSDDVN
FT                   GSGATTPDISSTVNDGSMPDSGTTAGESEQAGSSSDATAPTAIDASGAAIAPADRPQER
FT                   ADTELSDSPASPAPVQGHDSAPQGSDPAPTPPTTPVTGSSGAALDPIMAEDPAARGPVP
FT                   NAPAAIQDAVPATASAPEITTIDGATALTGIASDTKADASQVVTQALAPSLPTAAVDVA
FT                   SSVVSKVLGALGLRPFLSNDPQVPIESPTFWALAAAWCRRQEKVFTADANPTLAAAPVT
FT                   TSEPIESVAVTSTASTLTSTASTGTSSTSTAGPTVGAPDRSTGVVLGSINTSGDQLGYT
FT                   VTGQPSRGTVTVDETGGFRYTPTQAARQVAALDPSADYTSFDSFTVTPTSGQTSTPVTV
FT                   QVPVSAARMQVAQSTTVGSNPSGAVFTGTRTYVANQGSKSVSVLDTNDTVVGTVTVGTS
FT                   PTGVAANPAGTRVYVTNSGSGNVSVIDTATNTVVATVKTGTTPSAVAVNPAGTRAYVTN
FT                   SGSGTVSVINTATNTVVGSPIKVGITPNAVAVSPDGTRVYVTNRSSNTVSVINTATNTV
FT                   VATIRTGTTPNAVAVNPTGTRAYVTNRANNTVSVIDTATNSVVTTVAVGSQPTAVRVSP
FT                   DGSAAYVVSNPDRLTVIDARTNTVVSTLSIDSPTESGDHSIALSADGSRMLVTDATDGR
FT                   VRAVTLTHVNSEPTMSWTADAPRPSDGAVVVTLVDPRDPDGDPLTFTNTAPGSGSVVSD
FT                   GMTFTYTPTAAARDLALQTPGEDADHFTIALADGQAVTNIVVTVAISPTEVPDILEVES
FT                   TTIAVGSGPTGVVTAEDRIYVVSDEGFVRVIDPETNTVVGAPIEVDWASSNIAATSTSV
FT                   YVNSPYTGAISVIDTSTGTVVDTIWVDPAPDYQGYSLAQELAVSPDGTRLYASGEDGTV
FT                   SVIDTATNTVIASQLLGSYSSLEVSADGRYLYGTSGATVSVIDTASLTRTAEITVGPEW
FT                   DLTRTSSEFADVSHSVTVVNGNRLYVTHHVSTVERATGSFSNGQFITDSQGRLWRVTGG
FT                   YGLVSVIDIDPASATYGSTLDTVRLTGDAQDLALSPDGGRAFVTAGDGRTIAVIDTATN
FT                   TVVGTFVTDGEGAVTGPYGPLRTVSISSDTLYVTDYNDGAMYAVTGALDGAPAAVLT"
     MQLEKRFEAM GRPSPRMVRP DCSSKRPHGG VTMNSDKHLK HLGELAVAVG IGLAVAPAGT        60
     AVAAPSVGDS STSSSSDSSD QTSSDGRAAD RSTDGASSDR TSSGTSRTDS DSSSDGSRSS       120
     TTGDSTTDSQ STSGTDSQST SGTDTQSTTD TESTSATSSD DVNGSGATTP DISSTVNDGS       180
     MPDSGTTAGE SEQAGSSSDA TAPTAIDASG AAIAPADRPQ ERADTELSDS PASPAPVQGH       240
     DSAPQGSDPA PTPPTTPVTG SSGAALDPIM AEDPAARGPV PNAPAAIQDA VPATASAPEI       300
     TTIDGATALT GIASDTKADA SQVVTQALAP SLPTAAVDVA SSVVSKVLGA LGLRPFLSND       360
     PQVPIESPTF WALAAAWCRR QEKVFTADAN PTLAAAPVTT SEPIESVAVT STASTLTSTA       420
     STGTSSTSTA GPTVGAPDRS TGVVLGSINT SGDQLGYTVT GQPSRGTVTV DETGGFRYTP       480
     TQAARQVAAL DPSADYTSFD SFTVTPTSGQ TSTPVTVQVP VSAARMQVAQ STTVGSNPSG       540
     AVFTGTRTYV ANQGSKSVSV LDTNDTVVGT VTVGTSPTGV AANPAGTRVY VTNSGSGNVS       600
     VIDTATNTVV ATVKTGTTPS AVAVNPAGTR AYVTNSGSGT VSVINTATNT VVGSPIKVGI       660
     TPNAVAVSPD GTRVYVTNRS SNTVSVINTA TNTVVATIRT GTTPNAVAVN PTGTRAYVTN       720
     RANNTVSVID TATNSVVTTV AVGSQPTAVR VSPDGSAAYV VSNPDRLTVI DARTNTVVST       780
     LSIDSPTESG DHSIALSADG SRMLVTDATD GRVRAVTLTH VNSEPTMSWT ADAPRPSDGA       840
     VVVTLVDPRD PDGDPLTFTN TAPGSGSVVS DGMTFTYTPT AAARDLALQT PGEDADHFTI       900
     ALADGQAVTN IVVTVAISPT EVPDILEVES TTIAVGSGPT GVVTAEDRIY VVSDEGFVRV       960
     IDPETNTVVG APIEVDWASS NIAATSTSVY VNSPYTGAIS VIDTSTGTVV DTIWVDPAPD      1020
     YQGYSLAQEL AVSPDGTRLY ASGEDGTVSV IDTATNTVIA SQLLGSYSSL EVSADGRYLY      1080
     GTSGATVSVI DTASLTRTAE ITVGPEWDLT RTSSEFADVS HSVTVVNGNR LYVTHHVSTV      1140
     ERATGSFSNG QFITDSQGRL WRVTGGYGLV SVIDIDPASA TYGSTLDTVR LTGDAQDLAL      1200
     SPDGGRAFVT AGDGRTIAVI DTATNTVVGT FVTDGEGAVT GPYGPLRTVS ISSDTLYVTD      1260
     YNDGAMYAVT GALDGAPAAV LT                                               1282
//

If you have problems or comments...

PBIL Back to PBIL home page