(data stored in ACNUC7421 zone)

EMBL: AP011115.PE369

AP011115.PE369       Location/Qualifiers
FT   CDS             complement(381477..382016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48616"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD9"
FT                   /protein_id="BAH48616.1"
FT                   /translation="MADASLRITRLRTLIEHPRTGDTERAAAQRMLDRILSKSRSRYDT
FT                   SDRTYGARHDRVGRHAGLSRIADEIRDDIALARVVFSTPTLPGQLAAPDPIGDAPPGIT
FT                   YTVETPHDAGIVITINDVPADWGWISAGGVEAVSPALRALAGELAKLMDGYNHYGAHIG
FT                   RRFFGRIRVGGETLIW"
     MADASLRITR LRTLIEHPRT GDTERAAAQR MLDRILSKSR SRYDTSDRTY GARHDRVGRH        60
     AGLSRIADEI RDDIALARVV FSTPTLPGQL AAPDPIGDAP PGITYTVETP HDAGIVITIN       120
     DVPADWGWIS AGGVEAVSPA LRALAGELAK LMDGYNHYGA HIGRRFFGRI RVGGETLIW        179
//

If you have problems or comments...

PBIL Back to PBIL home page