(data stored in ACNUC7421 zone)

EMBL: AP011115.PE37

AP011115.PE37        Location/Qualifiers
FT   CDS             complement(31545..31958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48284"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS35"
FT                   /protein_id="BAH48284.1"
FT                   /translation="MTLALSTTLHTSFADAVDRTRKALADQGFGVLTEIDMKATLKAKL
FT                   GEDMEDYLILGACNPPLAHRAVTVDRQIGLLLPCNVVVRADPNNPGAVLIDAMNPQVMV
FT                   QVADQPGLGGVADDATAALQAAIDSLGAGAAKD"
     MTLALSTTLH TSFADAVDRT RKALADQGFG VLTEIDMKAT LKAKLGEDME DYLILGACNP        60
     PLAHRAVTVD RQIGLLLPCN VVVRADPNNP GAVLIDAMNP QVMVQVADQP GLGGVADDAT       120
     AALQAAIDSL GAGAAKD                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page