(data stored in ACNUC7421 zone)

EMBL: AP011115.PE370

AP011115.PE370       Location/Qualifiers
FT   CDS             complement(382108..383130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03700"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48617"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE0"
FT                   /protein_id="BAH48617.1"
FT                   /translation="MTQVRKSRQGARPWIRYLVGIVAVVVLAGCAAPDPLTPTVSGTYT
FT                   TRPMTNGAQIIPPTNNPPPEGPSPESCGALASLRPGPQPPPGQMPPGGALAEIASRGRL
FT                   IVGVDQNTNPFSFRDPTTGTLQGFDIDVAKEITKDIFGDPAKVEFRLLTSAGRFSALEQ
FT                   NDVDVVVHATAITCERARRVGFSTEYFRAFQRILVPRGSDITGPADLAGKRVCTFVDTT
FT                   SLPTVQRVAPEATIVAVPDWDDCLVTMQKRQADATSTSDALLAGLVSQDPHFQIVGPPM
FT                   EGEEHWGLAVNKYKDDLIRFVNGTLDRMRSDGTWMRLYDRWIAGSLGPIAGPPPATYRD
FT                   "
     MTQVRKSRQG ARPWIRYLVG IVAVVVLAGC AAPDPLTPTV SGTYTTRPMT NGAQIIPPTN        60
     NPPPEGPSPE SCGALASLRP GPQPPPGQMP PGGALAEIAS RGRLIVGVDQ NTNPFSFRDP       120
     TTGTLQGFDI DVAKEITKDI FGDPAKVEFR LLTSAGRFSA LEQNDVDVVV HATAITCERA       180
     RRVGFSTEYF RAFQRILVPR GSDITGPADL AGKRVCTFVD TTSLPTVQRV APEATIVAVP       240
     DWDDCLVTMQ KRQADATSTS DALLAGLVSQ DPHFQIVGPP MEGEEHWGLA VNKYKDDLIR       300
     FVNGTLDRMR SDGTWMRLYD RWIAGSLGPI AGPPPATYRD                             340
//

If you have problems or comments...

PBIL Back to PBIL home page