(data stored in ACNUC7421 zone)

EMBL: AP011115.PE371

AP011115.PE371       Location/Qualifiers
FT   CDS             complement(383130..384485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03710"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48618"
FT                   /db_xref="GOA:C1ARE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE1"
FT                   /protein_id="BAH48618.1"
FT                   /translation="MQEGRMFHRGDHVAIETPTLDEGLLVEPEGRRPWVEFLTSTPGRL
FT                   TVLGVALIAVVIAAGVITSAAVGARQQRVEVLRTHTEPLANAAQALYSSLSIADAAATT
FT                   SFISGGGASTGAEQFTQAVGDASNALVTATNGVSSQDAESLALLSDVVRNLAEYFNLVA
FT                   TAQANDRAGNPVGVAYLSDASALMQDTILPLAEQLYVRQAEAVAETQTHTAQLPAAAFT
FT                   VTAAALVALVLAQLYLVRKSKRRFNPGLAVASLLMAGLLIWLIAGSLVSTSASEHARTE
FT                   GTQPINTVARARILAQQARADETLALLQRGADTQSEVDYTRHSQALSDELTRQLDSAHG
FT                   DVAADDLRDAETAREGWLAAHRDIEIALERGDYPTAAAIAAGSGSGTSAAKFAVMDAAL
FT                   RDAIDRLRDDEAAAVTDAYRSMSSLAIGSMIIGVSCGFAVGGGIWPRLNEYH"
     MQEGRMFHRG DHVAIETPTL DEGLLVEPEG RRPWVEFLTS TPGRLTVLGV ALIAVVIAAG        60
     VITSAAVGAR QQRVEVLRTH TEPLANAAQA LYSSLSIADA AATTSFISGG GASTGAEQFT       120
     QAVGDASNAL VTATNGVSSQ DAESLALLSD VVRNLAEYFN LVATAQANDR AGNPVGVAYL       180
     SDASALMQDT ILPLAEQLYV RQAEAVAETQ THTAQLPAAA FTVTAAALVA LVLAQLYLVR       240
     KSKRRFNPGL AVASLLMAGL LIWLIAGSLV STSASEHART EGTQPINTVA RARILAQQAR       300
     ADETLALLQR GADTQSEVDY TRHSQALSDE LTRQLDSAHG DVAADDLRDA ETAREGWLAA       360
     HRDIEIALER GDYPTAAAIA AGSGSGTSAA KFAVMDAALR DAIDRLRDDE AAAVTDAYRS       420
     MSSLAIGSMI IGVSCGFAVG GGIWPRLNEY H                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page