(data stored in ACNUC7421 zone)

EMBL: AP011115.PE373

AP011115.PE373       Location/Qualifiers
FT   CDS             385015..385887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48620"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE3"
FT                   /protein_id="BAH48620.1"
FT                   /translation="MSSRGSAAEWASGQVHAVRDDPDARLELSARTYHGPVGNAPRHLP
FT                   FRRAALSFMRWQVGRGVLAALDASPPGSPWWRAVNERLLRDGCEAVARSGGMGGTPSSQ
FT                   AVDLWMLFVADPTARTWYRAHNASIVSAYLDHRGLAESESRPERFFLNVVLLRVLFAHA
FT                   LVAAPRLALGRLAPAGPLLGDPRLSMTGIFLSLSRVLPDRYPLGDDVAAYVAAEHNLGE
FT                   LLDYGLIGPRLQQLYEWSAAELDEPRLLGCIRDGSPTYAWSYTDREVWHPARPAATIRA
FT                   VRRFVPARR"
     MSSRGSAAEW ASGQVHAVRD DPDARLELSA RTYHGPVGNA PRHLPFRRAA LSFMRWQVGR        60
     GVLAALDASP PGSPWWRAVN ERLLRDGCEA VARSGGMGGT PSSQAVDLWM LFVADPTART       120
     WYRAHNASIV SAYLDHRGLA ESESRPERFF LNVVLLRVLF AHALVAAPRL ALGRLAPAGP       180
     LLGDPRLSMT GIFLSLSRVL PDRYPLGDDV AAYVAAEHNL GELLDYGLIG PRLQQLYEWS       240
     AAELDEPRLL GCIRDGSPTY AWSYTDREVW HPARPAATIR AVRRFVPARR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page