(data stored in ACNUC7421 zone)

EMBL: AP011115.PE375

AP011115.PE375       Location/Qualifiers
FT   CDS             complement(386963..387706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48622"
FT                   /db_xref="GOA:C1ARE5"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE5"
FT                   /protein_id="BAH48622.1"
FT                   /translation="MENSTPVTPPIRLDDLIEAIKKGHAEAPLEQLTDAVLAAEHLGDL
FT                   ADHLIGHFVDQARRSGASWTEIGKSMGVTKQAAQKRFVPKDPGQASDLDPNQGFSRFTP
FT                   RARQVVVVAQNEARAASNSEILPQHLVLGLLTDPDGLGARAIAAQGVDLDTVRHAATAT
FT                   LPPAVEEIPALIPFDAQSRKALELTFREALRLGHNYIGTEHILLALLEVEDGVGVLAGL
FT                   GVDKAAVEENIAANLAAIVAARTEE"
     MENSTPVTPP IRLDDLIEAI KKGHAEAPLE QLTDAVLAAE HLGDLADHLI GHFVDQARRS        60
     GASWTEIGKS MGVTKQAAQK RFVPKDPGQA SDLDPNQGFS RFTPRARQVV VVAQNEARAA       120
     SNSEILPQHL VLGLLTDPDG LGARAIAAQG VDLDTVRHAA TATLPPAVEE IPALIPFDAQ       180
     SRKALELTFR EALRLGHNYI GTEHILLALL EVEDGVGVLA GLGVDKAAVE ENIAANLAAI       240
     VAARTEE                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page