(data stored in ACNUC7421 zone)

EMBL: AP011115.PE377

AP011115.PE377       Location/Qualifiers
FT   CDS             388201..389556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03770"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48624"
FT                   /db_xref="GOA:C1ARE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE7"
FT                   /protein_id="BAH48624.1"
FT                   /translation="MVVMDTDKELESQIGQWRGYVERRHAISAADTDEMEDHLRDQISD
FT                   LSAAGLETDEAFLVAVKRMGNVDDISREFAREHSDRLWKQLVLIPAAPDGDRTRPTREL
FT                   FVVLGFAVGAALALEAGLATLDEQDLARNLSLFILPFLAGYFAWKRKVTLRLAAALVVP
FT                   FVLAAVLLNVFPFVSNGSTEVIAAIHAPIALWFAVGVAYIGGQWRSDRRRMDFIRFTGE
FT                   WVVYLTLLALGGGVLIGLTVNAFDALGLSVEWVVEDWVLPFGAAGAVIVAAWLVEAKQN
FT                   VVENIAPVLTRVFTPLTTLMLLVLLIAFATTGSVVDVDRNLLILMDLILVVVLGLLLYA
FT                   ISARDPYLPPDLFDRLQFVLVVSALAVDLLMLFAMLTRIAEFGFTPNKVAALGMNLVLL
FT                   VNLTWSAVLILGFLRGRREFGSTENWQTRYLPVFGVWAALMVGVLPPIFDFT"
     MVVMDTDKEL ESQIGQWRGY VERRHAISAA DTDEMEDHLR DQISDLSAAG LETDEAFLVA        60
     VKRMGNVDDI SREFAREHSD RLWKQLVLIP AAPDGDRTRP TRELFVVLGF AVGAALALEA       120
     GLATLDEQDL ARNLSLFILP FLAGYFAWKR KVTLRLAAAL VVPFVLAAVL LNVFPFVSNG       180
     STEVIAAIHA PIALWFAVGV AYIGGQWRSD RRRMDFIRFT GEWVVYLTLL ALGGGVLIGL       240
     TVNAFDALGL SVEWVVEDWV LPFGAAGAVI VAAWLVEAKQ NVVENIAPVL TRVFTPLTTL       300
     MLLVLLIAFA TTGSVVDVDR NLLILMDLIL VVVLGLLLYA ISARDPYLPP DLFDRLQFVL       360
     VVSALAVDLL MLFAMLTRIA EFGFTPNKVA ALGMNLVLLV NLTWSAVLIL GFLRGRREFG       420
     STENWQTRYL PVFGVWAALM VGVLPPIFDF T                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page