(data stored in ACNUC7421 zone)

EMBL: AP011115.PE38

AP011115.PE38        Location/Qualifiers
FT   CDS             complement(32016..32264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48285"
FT                   /db_xref="GOA:C1AS36"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS36"
FT                   /protein_id="BAH48285.1"
FT                   /translation="MTDALHAPRWTIERVVPLLAGTVVLASLALTLVFSSGWLLLTGFV
FT                   GANLLLFGAVGWCPASLLLRRLGVPRRTASCPAPAGR"
     MTDALHAPRW TIERVVPLLA GTVVLASLAL TLVFSSGWLL LTGFVGANLL LFGAVGWCPA        60
     SLLLRRLGVP RRTASCPAPA GR                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page