(data stored in ACNUC7421 zone)

EMBL: AP011115.PE380

AP011115.PE380       Location/Qualifiers
FT   CDS             complement(393517..394515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48627"
FT                   /db_xref="GOA:C1ARF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF0"
FT                   /protein_id="BAH48627.1"
FT                   /translation="MSDSGHLMIEYGRGAVSGQDVNEAVAGLFRSIASNCRGSALPDRL
FT                   HESLVETTDLDALLQSVRLAIAPDLDPAEEERKRCQLARLVAATKGRPRPDGPTVEERA
FT                   AGEKPPPVAAGSTLASPGWFPPVRNPWHRRRRRPSRRQGALGVVAILILFAAVVAAPRA
FT                   WSELRRGWDAVLNPVNAEEQNQIRPVSPPPPEPPVGLPTPAMSDAGRVPPPVDVGAPGS
FT                   AGPITLVTATRANGECGPGQACAIRVDVHLDPAATVDAVTWRVNVYDRCSGEVRAGGDV
FT                   SERVQPGSQQVYGVVRTDLPAGAALAVAAITSAPATAASEPLLMPAENARC"
     MSDSGHLMIE YGRGAVSGQD VNEAVAGLFR SIASNCRGSA LPDRLHESLV ETTDLDALLQ        60
     SVRLAIAPDL DPAEEERKRC QLARLVAATK GRPRPDGPTV EERAAGEKPP PVAAGSTLAS       120
     PGWFPPVRNP WHRRRRRPSR RQGALGVVAI LILFAAVVAA PRAWSELRRG WDAVLNPVNA       180
     EEQNQIRPVS PPPPEPPVGL PTPAMSDAGR VPPPVDVGAP GSAGPITLVT ATRANGECGP       240
     GQACAIRVDV HLDPAATVDA VTWRVNVYDR CSGEVRAGGD VSERVQPGSQ QVYGVVRTDL       300
     PAGAALAVAA ITSAPATAAS EPLLMPAENA RC                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page