(data stored in ACNUC7421 zone)

EMBL: AP011115.PE381

AP011115.PE381       Location/Qualifiers
FT   CDS             complement(394940..396454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03810"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48628"
FT                   /db_xref="GOA:C1ARF1"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF1"
FT                   /protein_id="BAH48628.1"
FT                   /translation="MSRWWPLAAAAVLVVVLALGRVVPVWPGLLHLVALPPLDQFADLR
FT                   LLLVRTDSWPQFLVLLAVVSAVRILLMAWMLGGLDSRRIRFATAFYATAFGPVLLASCA
FT                   DATAYAMLYSRAFWPAVALVAVVVWILGPVPWQGGAGLRAAMGRAWRRGLRIEVMVPYC
FT                   AAILALGALADRVPALTVLLVPVSAAATGLTVWAMDRAPLRRPVAALAAVLVASTVVSV
FT                   AFVPTRAYDYPEPGPRQAGSLLVMSGIDSRSGEGTMYRADVQRLGYECEQVYYFSYAGT
FT                   GGGQPRRNAGCPIRTGAPYEPADTQRPVGEQVALFAEQAANLQRPLTVAAHSHAGWIAW
FT                   EAVAAGRARVDVLILVGVFPETPLGFPPPDVERPGRVFGDLLRWAVPAIEVAFFPFDPD
FT                   TPAARQLLGEAGSAQAVLGETLPEEVRVLSVASVADLPLMPHGWRLDVERNGCPVRAAH
FT                   SSLPVSAAFDDEVIRFLNHRDPLPCPAWRDWGAVVMRALGVPPSGR"
     MSRWWPLAAA AVLVVVLALG RVVPVWPGLL HLVALPPLDQ FADLRLLLVR TDSWPQFLVL        60
     LAVVSAVRIL LMAWMLGGLD SRRIRFATAF YATAFGPVLL ASCADATAYA MLYSRAFWPA       120
     VALVAVVVWI LGPVPWQGGA GLRAAMGRAW RRGLRIEVMV PYCAAILALG ALADRVPALT       180
     VLLVPVSAAA TGLTVWAMDR APLRRPVAAL AAVLVASTVV SVAFVPTRAY DYPEPGPRQA       240
     GSLLVMSGID SRSGEGTMYR ADVQRLGYEC EQVYYFSYAG TGGGQPRRNA GCPIRTGAPY       300
     EPADTQRPVG EQVALFAEQA ANLQRPLTVA AHSHAGWIAW EAVAAGRARV DVLILVGVFP       360
     ETPLGFPPPD VERPGRVFGD LLRWAVPAIE VAFFPFDPDT PAARQLLGEA GSAQAVLGET       420
     LPEEVRVLSV ASVADLPLMP HGWRLDVERN GCPVRAAHSS LPVSAAFDDE VIRFLNHRDP       480
     LPCPAWRDWG AVVMRALGVP PSGR                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page