(data stored in ACNUC7421 zone)

EMBL: AP011115.PE382

AP011115.PE382       Location/Qualifiers
FT   CDS             396589..397110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48629"
FT                   /db_xref="GOA:C1ARF2"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF2"
FT                   /protein_id="BAH48629.1"
FT                   /translation="MTFPGGIGEDDHLMDGSEVGSHRSLMTFDQFEDIFRVAASIGVVR
FT                   DDFHRFDDVVTGKLYDLLLVAQSDAAAQHRNVIELTDLPITRGLQENIGLFRELGPHLR
FT                   AGPILERLTDYPPLGGALATDTRSGLPDITGGLSVALARTFRIVYPELRTLRARTTHWA
FT                   LVSTLVDLYL"
     MTFPGGIGED DHLMDGSEVG SHRSLMTFDQ FEDIFRVAAS IGVVRDDFHR FDDVVTGKLY        60
     DLLLVAQSDA AAQHRNVIEL TDLPITRGLQ ENIGLFRELG PHLRAGPILE RLTDYPPLGG       120
     ALATDTRSGL PDITGGLSVA LARTFRIVYP ELRTLRARTT HWALVSTLVD LYL              173
//

If you have problems or comments...

PBIL Back to PBIL home page