(data stored in ACNUC7421 zone)

EMBL: AP011115.PE383

AP011115.PE383       Location/Qualifiers
FT   CDS             397297..397695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48630"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF3"
FT                   /protein_id="BAH48630.1"
FT                   /translation="MNSTKTRIAAAAATGAAIGLGMFMAQSATAVAAPAQATSPQVVSP
FT                   DSGLSPYKVEVRDRIGCANAWPMVACDAPDEDVPPQVTLVEPGTTLVEPGGTSLFGPAS
FT                   ATIHQVNYPLEPDDGVISHSLDPDMPWM"
     MNSTKTRIAA AAATGAAIGL GMFMAQSATA VAAPAQATSP QVVSPDSGLS PYKVEVRDRI        60
     GCANAWPMVA CDAPDEDVPP QVTLVEPGTT LVEPGGTSLF GPASATIHQV NYPLEPDDGV       120
     ISHSLDPDMP WM                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page