(data stored in ACNUC7421 zone)

EMBL: AP011115.PE384

AP011115.PE384       Location/Qualifiers
FT   CDS             397978..399447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03840"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48631"
FT                   /db_xref="GOA:C1ARF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF4"
FT                   /protein_id="BAH48631.1"
FT                   /translation="MTTERVMGSKAADQECQDCGYEPELKRTLGSFQVFAVSFAFISVA
FT                   VGIFGTYDDVLRDAGPVGIWLWVVVALGQILVALVIAQFAARIPLSGSSYQWASRLANP
FT                   KVGWLFGWLTFCYLALGVVTVDNAMASSALMPLFGMQPDEGTARVITLVVVLVQAVLVV
FT                   FSTRLVGLITSGAVGLELVIVVVLAIGLFVAVPITGEGSVGNLTSRGVAEGAPNYFAVG
FT                   GGLMAATIMGLATLVGFDSAANMAEEAKDPFRSVPRAIVGSVVAAAVLGLVFLIALTIA
FT                   IEDVPRISDSDTPVAAILRDQLGPVMERTLLVAIAFAFFGAGMVTLATCSRMVFAMSRD
FT                   ARFPAHRLMRRVNPRTQTPIPATILIVVVGVVLMAALPGGALLELLTVGTVISAVLYGG
FT                   IVVLYLAVRTRLDRKEGAFDLGRFELPVAICALVWSAFVVFVIVSPSTALTSILIAVGL
FT                   LLAGGVYFTYLLIFKRDVLDTEPGDADVFAH"
     MTTERVMGSK AADQECQDCG YEPELKRTLG SFQVFAVSFA FISVAVGIFG TYDDVLRDAG        60
     PVGIWLWVVV ALGQILVALV IAQFAARIPL SGSSYQWASR LANPKVGWLF GWLTFCYLAL       120
     GVVTVDNAMA SSALMPLFGM QPDEGTARVI TLVVVLVQAV LVVFSTRLVG LITSGAVGLE       180
     LVIVVVLAIG LFVAVPITGE GSVGNLTSRG VAEGAPNYFA VGGGLMAATI MGLATLVGFD       240
     SAANMAEEAK DPFRSVPRAI VGSVVAAAVL GLVFLIALTI AIEDVPRISD SDTPVAAILR       300
     DQLGPVMERT LLVAIAFAFF GAGMVTLATC SRMVFAMSRD ARFPAHRLMR RVNPRTQTPI       360
     PATILIVVVG VVLMAALPGG ALLELLTVGT VISAVLYGGI VVLYLAVRTR LDRKEGAFDL       420
     GRFELPVAIC ALVWSAFVVF VIVSPSTALT SILIAVGLLL AGGVYFTYLL IFKRDVLDTE       480
     PGDADVFAH                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page