(data stored in ACNUC7421 zone)

EMBL: AP011115.PE39

AP011115.PE39        Location/Qualifiers
FT   CDS             complement(32301..32570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48286"
FT                   /db_xref="GOA:C1AS37"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS37"
FT                   /protein_id="BAH48286.1"
FT                   /translation="MVGDEDSIALVLNRLRRAHGQLAGVISMIEQGRDCKDVVTQLAAV
FT                   SRALDKAGFKIVATGLRECLTGEAPEGKEPMTEAELEKLFLALA"
     MVGDEDSIAL VLNRLRRAHG QLAGVISMIE QGRDCKDVVT QLAAVSRALD KAGFKIVATG        60
     LRECLTGEAP EGKEPMTEAE LEKLFLALA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page