(data stored in ACNUC7421 zone)

EMBL: AP011115.PE390

AP011115.PE390       Location/Qualifiers
FT   CDS             404636..405997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48637"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG0"
FT                   /protein_id="BAH48637.1"
FT                   /translation="MDLRTQDEADDVFTRGDALQASVPSRAHDHAATGAGRPDVLNFVE
FT                   ADNEGRLTHLVPLRIGRMIASPFAFFRGAAGLMAADLAASPVTGLTAQLCGDAHAANFG
FT                   LYGTPDGQIVMDINDFDETLPGPWEWDLKRLAASLVLAGREGGVSESGCVEAAEDAVKS
FT                   YRRTMRDLAELPFLQSWNALPDKSVLARAKADALLDDFDKAAQKARRNTSEKVAAKWTA
FT                   HFENHETGIRRRRFVDDPPILTHVDRATADAVTDGLERYVDSLRESRRNLITRFVVSDV
FT                   AFRIVGTGSVGLRSYIALLHGNRDEVLVLQLKQARPSALAAYLPVDEPKHEGKRIVHGA
FT                   RLVQAESDILLGWTTIDGLPYIVRQFRNLKGDIDPTGLEQDHLDDYGRLAGALLARAHT
FT                   RSLDPRALAGYFAGDTELDEAIGRYAVRYADQTEADHAELVAAVKSGRMAAEPA"
     MDLRTQDEAD DVFTRGDALQ ASVPSRAHDH AATGAGRPDV LNFVEADNEG RLTHLVPLRI        60
     GRMIASPFAF FRGAAGLMAA DLAASPVTGL TAQLCGDAHA ANFGLYGTPD GQIVMDINDF       120
     DETLPGPWEW DLKRLAASLV LAGREGGVSE SGCVEAAEDA VKSYRRTMRD LAELPFLQSW       180
     NALPDKSVLA RAKADALLDD FDKAAQKARR NTSEKVAAKW TAHFENHETG IRRRRFVDDP       240
     PILTHVDRAT ADAVTDGLER YVDSLRESRR NLITRFVVSD VAFRIVGTGS VGLRSYIALL       300
     HGNRDEVLVL QLKQARPSAL AAYLPVDEPK HEGKRIVHGA RLVQAESDIL LGWTTIDGLP       360
     YIVRQFRNLK GDIDPTGLEQ DHLDDYGRLA GALLARAHTR SLDPRALAGY FAGDTELDEA       420
     IGRYAVRYAD QTEADHAELV AAVKSGRMAA EPA                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page