(data stored in ACNUC7421 zone)

EMBL: AP011115.PE391

AP011115.PE391       Location/Qualifiers
FT   CDS             complement(406017..406367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48638"
FT                   /db_xref="GOA:C1ARG1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG1"
FT                   /protein_id="BAH48638.1"
FT                   /translation="MESLALASAVVEQLAPVATKSRRTRTGRTVQDVVPAPSIHLRVAV
FT                   TWVSIFPLVTLGMTVMTLSGPITATWPTWLRALSLTGVVVPTAVYFVVPRILAVALRWL
FT                   SWRRRRSAATPG"
     MESLALASAV VEQLAPVATK SRRTRTGRTV QDVVPAPSIH LRVAVTWVSI FPLVTLGMTV        60
     MTLSGPITAT WPTWLRALSL TGVVVPTAVY FVVPRILAVA LRWLSWRRRR SAATPG           116
//

If you have problems or comments...

PBIL Back to PBIL home page