(data stored in ACNUC7421 zone)

EMBL: AP011115.PE394

AP011115.PE394       Location/Qualifiers
FT   CDS             408297..408824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48641"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG4"
FT                   /protein_id="BAH48641.1"
FT                   /translation="MRTASWVSAATAVLLGATAAAAWRKANLADQARHEAEAALEAALG
FT                   QLEAMTRIAEAAQQALPRPLEVEFDVQRIRGPVDRFRLHNVGTGIATDVRFVVDPAEEQ
FT                   NRRVPTPQWLHEGAVTLLPKEWADFSASALSPVAGSWRIVFPAFVTVIHDGAGTPQRVD
FT                   LPTTVTEDGVIG"
     MRTASWVSAA TAVLLGATAA AAWRKANLAD QARHEAEAAL EAALGQLEAM TRIAEAAQQA        60
     LPRPLEVEFD VQRIRGPVDR FRLHNVGTGI ATDVRFVVDP AEEQNRRVPT PQWLHEGAVT       120
     LLPKEWADFS ASALSPVAGS WRIVFPAFVT VIHDGAGTPQ RVDLPTTVTE DGVIG            175
//

If you have problems or comments...

PBIL Back to PBIL home page