(data stored in ACNUC7421 zone)

EMBL: AP011115.PE396

AP011115.PE396       Location/Qualifiers
FT   CDS             409487..409969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48643"
FT                   /db_xref="GOA:C1ARG6"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG6"
FT                   /protein_id="BAH48643.1"
FT                   /translation="MQYADNIRISDSERDQVVAELGRHLTAGRLTIGEFDQRAAEVYRS
FT                   TTRQQAHQVLRDLPSAAPTVAAASVTTPPTRPARRRIPGHQKIEWLAWAVAGGINIAIW
FT                   GIVSLATGAMIYAWPVWVIGPWGLVLLGRTVLGRESGCSKFTDALRDDRMRAVASR"
     MQYADNIRIS DSERDQVVAE LGRHLTAGRL TIGEFDQRAA EVYRSTTRQQ AHQVLRDLPS        60
     AAPTVAAASV TTPPTRPARR RIPGHQKIEW LAWAVAGGIN IAIWGIVSLA TGAMIYAWPV       120
     WVIGPWGLVL LGRTVLGRES GCSKFTDALR DDRMRAVASR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page