(data stored in ACNUC7421 zone)

EMBL: AP011115.PE397

AP011115.PE397       Location/Qualifiers
FT   CDS             410014..410415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48644"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG7"
FT                   /protein_id="BAH48644.1"
FT                   /translation="MKRVVQSRIVSSVAPRSLSHPCTPPGRASQRARTPSMASGTRPRR
FT                   SRSLGCARPGSGAKQHRSGRGGRHLQDVHEPVPRIEPVAYGYAAQNRPGTPESAEARKG
FT                   DQRRRDQARHSLQPTAWGPARTRNRYTPR"
     MKRVVQSRIV SSVAPRSLSH PCTPPGRASQ RARTPSMASG TRPRRSRSLG CARPGSGAKQ        60
     HRSGRGGRHL QDVHEPVPRI EPVAYGYAAQ NRPGTPESAE ARKGDQRRRD QARHSLQPTA       120
     WGPARTRNRY TPR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page