(data stored in ACNUC7421 zone)

EMBL: AP011115.PE398

AP011115.PE398       Location/Qualifiers
FT   CDS             410516..410857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48645"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG8"
FT                   /protein_id="BAH48645.1"
FT                   /translation="MPAPMNAQPMTCGDYVTATFARDFVAEGFDHDTVERIHRGLFDEW
FT                   THALAQSGLFSNGTVAAALDSWQDDPHSLLTALLANADEITLKRYDLVWEALERSAHAG
FT                   SADAVVEYA"
     MPAPMNAQPM TCGDYVTATF ARDFVAEGFD HDTVERIHRG LFDEWTHALA QSGLFSNGTV        60
     AAALDSWQDD PHSLLTALLA NADEITLKRY DLVWEALERS AHAGSADAVV EYA              113
//

If you have problems or comments...

PBIL Back to PBIL home page