(data stored in ACNUC7421 zone)

EMBL: AP011115.PE4

AP011115.PE4         Location/Qualifiers
FT   CDS             2534..3160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48251"
FT                   /db_xref="GOA:C1AS02"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS02"
FT                   /protein_id="BAH48251.1"
FT                   /translation="MDLIRPLQTVTPTLDGDVLSALAAASEATFTTGQLHRVLHHHSEE
FT                   GIRKVLQRLSKQGTVLSSRVGNAFVYQLNREHLAFPHVVGLADLSGEFLRRLEARLAGW
FT                   EIPPVYAAVFGSAARGTMTIDSDIDIFLVRPDDVAEEEWDEQVAELMAEVTRWTGNDAR
FT                   DLQFAQSEIAGRGTDEPVLRDVVKEGLTVAGSRAGFTRLLRRGNR"
     MDLIRPLQTV TPTLDGDVLS ALAAASEATF TTGQLHRVLH HHSEEGIRKV LQRLSKQGTV        60
     LSSRVGNAFV YQLNREHLAF PHVVGLADLS GEFLRRLEAR LAGWEIPPVY AAVFGSAARG       120
     TMTIDSDIDI FLVRPDDVAE EEWDEQVAEL MAEVTRWTGN DARDLQFAQS EIAGRGTDEP       180
     VLRDVVKEGL TVAGSRAGFT RLLRRGNR                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page