(data stored in ACNUC7421 zone)

EMBL: AP011115.PE40

AP011115.PE40        Location/Qualifiers
FT   CDS             complement(32665..34821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00400"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48287"
FT                   /db_xref="GOA:C1AS38"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS38"
FT                   /protein_id="BAH48287.1"
FT                   /translation="MTRSTALGGDAPPADTITAGGVLGRMGAAMAGHAKWVFGIWLILL
FT                   VVLGAAAPSVFSSLAGAGWQANGSESVQVRELAQQHFGGNSSAAVQVVVHSDTQTIDGP
FT                   QMQQTLGEVGAVFAGDPRFGAVIAPQPGMSISPDGHTGILIAGANASTDEMVKAVDDHK
FT                   AALTALTGDGIEVYPTGASALWSDFNKANHDAMIQAELFSWPVTLAIMVLAFGSLVAAG
FT                   LPLLLTLAGLVASAGGLVLLNEITPISVWAMNFAMMFALALGIDYALFIVARFRDALTN
FT                   GGGPRAAVAETMDTAGKAVVLSGITVLVSLSAVLLVPAPAVRTMAVGIMLAVFFVLVAS
FT                   MTLLPAVLGALGGRVNAGSLPYAKRQQHRSPRFAAWGELLHRHPWPFAIGSLLVLIALA
FT                   APVLGLKVAMPSIEVVPTDAPVRQGYELVQAQMGEGAPGMLQIIGPAGEGTDAAAAAAA
FT                   TDGIAMVTPPQPAPDGSDYVMLQAMPTVDPSDGQMGTIVDALRAGLPDGAVVGGAPAEN
FT                   LDLQQALNDYLPLIVGIILILGFVLLLVALQAPLIAVLGTVVSLLSTAAAFGVAKLIFQ
FT                   DGHGASLLGFTPQGFLDGWGPVFFFAMIFAIAMDYTVFLLATAKEHYERSGDPKVAHVD
FT                   GLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAVLIRLVLLPVLLR
FT                   LTGHAAWWSPAWLRKVLPNISFSH"
     MTRSTALGGD APPADTITAG GVLGRMGAAM AGHAKWVFGI WLILLVVLGA AAPSVFSSLA        60
     GAGWQANGSE SVQVRELAQQ HFGGNSSAAV QVVVHSDTQT IDGPQMQQTL GEVGAVFAGD       120
     PRFGAVIAPQ PGMSISPDGH TGILIAGANA STDEMVKAVD DHKAALTALT GDGIEVYPTG       180
     ASALWSDFNK ANHDAMIQAE LFSWPVTLAI MVLAFGSLVA AGLPLLLTLA GLVASAGGLV       240
     LLNEITPISV WAMNFAMMFA LALGIDYALF IVARFRDALT NGGGPRAAVA ETMDTAGKAV       300
     VLSGITVLVS LSAVLLVPAP AVRTMAVGIM LAVFFVLVAS MTLLPAVLGA LGGRVNAGSL       360
     PYAKRQQHRS PRFAAWGELL HRHPWPFAIG SLLVLIALAA PVLGLKVAMP SIEVVPTDAP       420
     VRQGYELVQA QMGEGAPGML QIIGPAGEGT DAAAAAAATD GIAMVTPPQP APDGSDYVML       480
     QAMPTVDPSD GQMGTIVDAL RAGLPDGAVV GGAPAENLDL QQALNDYLPL IVGIILILGF       540
     VLLLVALQAP LIAVLGTVVS LLSTAAAFGV AKLIFQDGHG ASLLGFTPQG FLDGWGPVFF       600
     FAMIFAIAMD YTVFLLATAK EHYERSGDPK VAHVDGLAHS GRVIFAAAAV MVAVFFTFAL       660
     ADPLPPKEMG IILGVAVLLD AVLIRLVLLP VLLRLTGHAA WWSPAWLRKV LPNISFSH         718
//

If you have problems or comments...

PBIL Back to PBIL home page