(data stored in ACNUC7421 zone)

EMBL: AP011115.PE400

AP011115.PE400       Location/Qualifiers
FT   CDS             411153..411407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48647"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH0"
FT                   /protein_id="BAH48647.1"
FT                   /translation="MNAPAMQLLPPRDGLADYRDAVDALRALETHGSLRADPRTALLFD
FT                   SLTDDLIEAAQTNEAGDTMSQREVFAMIDFAISRPRPSL"
     MNAPAMQLLP PRDGLADYRD AVDALRALET HGSLRADPRT ALLFDSLTDD LIEAAQTNEA        60
     GDTMSQREVF AMIDFAISRP RPSL                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page