(data stored in ACNUC7421 zone)

EMBL: AP011115.PE401

AP011115.PE401       Location/Qualifiers
FT   CDS             411582..412307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04010"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48648"
FT                   /db_xref="GOA:C1ARH1"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH1"
FT                   /protein_id="BAH48648.1"
FT                   /translation="MTNDRSESPQSRPKPGGTRRRLPWLLAAAAVAVVGAVAIGAYVLT
FT                   AGSDDARKAHDFAPSADNPDPSLGIEGIVTVDYPPADHVQAPQRVAYEESPPFGGAHDQ
FT                   YWATCTGIVYPEAIRAENAVHSLEHGAVWVTYDPDHLSADDVTALAAHVDGVPYTLMSP
FT                   YPGLDSAVSLQSWGHQLRLDDVHDQRIADFLTALRQNPNTYPEPGATCSTVRGGFDPAD
FT                   PPPFDPSAPGPDAVPVDGN"
     MTNDRSESPQ SRPKPGGTRR RLPWLLAAAA VAVVGAVAIG AYVLTAGSDD ARKAHDFAPS        60
     ADNPDPSLGI EGIVTVDYPP ADHVQAPQRV AYEESPPFGG AHDQYWATCT GIVYPEAIRA       120
     ENAVHSLEHG AVWVTYDPDH LSADDVTALA AHVDGVPYTL MSPYPGLDSA VSLQSWGHQL       180
     RLDDVHDQRI ADFLTALRQN PNTYPEPGAT CSTVRGGFDP ADPPPFDPSA PGPDAVPVDG       240
     N                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page