(data stored in ACNUC7421 zone)

EMBL: AP011115.PE404

AP011115.PE404       Location/Qualifiers
FT   CDS             413977..414891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48651"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH4"
FT                   /protein_id="BAH48651.1"
FT                   /translation="MFEERPSQQISIVRLEVRRSRSTSANVAEHVGIHPRLLAGIGAEP
FT                   RQQVRVSREGTTALFTLVPGNGAGGIDTVQVTDGGCRRIGAESGHAVVLDLRCIDPTMS
FT                   EAEAEVEGEFIERLEDDGRHHRLAVLAPHGGAIESHTDRQAEQVYASLGSRDSTLWTCK
FT                   GWRPVGNAYRAWHISSGDLSVRSFPLLRSLAARRFRWAVSFHGYRGDDVLIGGRAPARL
FT                   KSEVLDAVATALDGTGIRVRVADPGERYSGESASNLVNRLTVGAAGGIQIEQPRSARTL
FT                   YGQAIAAAVGEVCESWIAADSGR"
     MFEERPSQQI SIVRLEVRRS RSTSANVAEH VGIHPRLLAG IGAEPRQQVR VSREGTTALF        60
     TLVPGNGAGG IDTVQVTDGG CRRIGAESGH AVVLDLRCID PTMSEAEAEV EGEFIERLED       120
     DGRHHRLAVL APHGGAIESH TDRQAEQVYA SLGSRDSTLW TCKGWRPVGN AYRAWHISSG       180
     DLSVRSFPLL RSLAARRFRW AVSFHGYRGD DVLIGGRAPA RLKSEVLDAV ATALDGTGIR       240
     VRVADPGERY SGESASNLVN RLTVGAAGGI QIEQPRSART LYGQAIAAAV GEVCESWIAA       300
     DSGR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page