(data stored in ACNUC7421 zone)

EMBL: AP011115.PE406

AP011115.PE406       Location/Qualifiers
FT   CDS             complement(416349..416843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48653"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH6"
FT                   /protein_id="BAH48653.1"
FT                   /translation="MRRAGKILAGIGMATVITATGQGIAVAAPEGTTESVTTLQVPPIG
FT                   MSPVLAAYFTVDAVTGRVPGVVRFRTVSECYVLNPISADTCIPGPGNAMRANAVRVHWL
FT                   NMNTGATGAVTIPIGTAGSTDSPRPEIDVATGSGRIVVGTMAPAEYPQALLPGFGTFDV
FT                   P"
     MRRAGKILAG IGMATVITAT GQGIAVAAPE GTTESVTTLQ VPPIGMSPVL AAYFTVDAVT        60
     GRVPGVVRFR TVSECYVLNP ISADTCIPGP GNAMRANAVR VHWLNMNTGA TGAVTIPIGT       120
     AGSTDSPRPE IDVATGSGRI VVGTMAPAEY PQALLPGFGT FDVP                        164
//

If you have problems or comments...

PBIL Back to PBIL home page