(data stored in ACNUC7421 zone)

EMBL: AP011115.PE407

AP011115.PE407       Location/Qualifiers
FT   CDS             417021..417203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48654"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH7"
FT                   /protein_id="BAH48654.1"
FT                   /translation="MRTALCNALFAAFDHRICCGRIPEWTAHVGQTWDTYDIAPWNLYN
FT                   VIWRIQNWIRCGIRD"
     MRTALCNALF AAFDHRICCG RIPEWTAHVG QTWDTYDIAP WNLYNVIWRI QNWIRCGIRD        60
//

If you have problems or comments...

PBIL Back to PBIL home page