(data stored in ACNUC7421 zone)

EMBL: AP011115.PE408

AP011115.PE408       Location/Qualifiers
FT   CDS             complement(417234..417623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48655"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH8"
FT                   /protein_id="BAH48655.1"
FT                   /translation="MKVTATATRRGGSWVVKVPGVEGAVTEARRLDQISAMVAEAVHLV
FT                   EGVRAEDVEVELDYDIGDPAALMEARAAHWQVESAAHAQECAARASRAAVAHLRRSGLS
FT                   VRDIGVILDLSPQRVSQLDRAGLHA"
     MKVTATATRR GGSWVVKVPG VEGAVTEARR LDQISAMVAE AVHLVEGVRA EDVEVELDYD        60
     IGDPAALMEA RAAHWQVESA AHAQECAARA SRAAVAHLRR SGLSVRDIGV ILDLSPQRVS       120
     QLDRAGLHA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page