(data stored in ACNUC7421 zone)

EMBL: AP011115.PE409

AP011115.PE409       Location/Qualifiers
FT   CDS             complement(417765..420794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04090"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48656"
FT                   /db_xref="GOA:C1ARH9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR030605"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH9"
FT                   /protein_id="BAH48656.1"
FT                   /translation="MADFDPDATQAASVRAVGHGIVAELDAAGFAGAEEVGRGGFGVVY
FT                   RCLQRSLGRIVAIKVLTSDLDSENRERFLREGYAMGGLSGHPNIVNILQVGVTETGRPY
FT                   IVMHYHPRDSLAVQIRREGPLPWPEAISIGVKLAGALETAHRTGTLHRDIKPANILLTD
FT                   YGEPQLTDFGIAHIAGGYETATGGFTGSLAFTAPEVLNGESPTARSDVYGLGATIFSLI
FT                   AGRAAFERKTGEELVAQFVRISTQTVPDLRAQGIPDGVCAVIERAMAPNPFARPASAEE
FT                   FGHELQAAQRHIGLRSDAMALAPLEPAQPGQAHPAADAGGYRQIRFEDSDGQRRFFAST
FT                   EQIQPDSHPSAPFWPPTGPSPWPPPEARGRSGPARGRRRGILIVLALVVTLVLAGGGYL
FT                   VFREATGPGTAGPIAQDGGEPPAVDPTAAWRPVGDARVARQQTATTVADGTIWVFGGLD
FT                   DNGVSARQEGYDPAIDTWKAGPDLPVPLNHAMAVTYNDEPVLIGGWQAKGQNLTAVASA
FT                   RVMAMRDGRWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELVSPTEVFDGTKWTTVA
FT                   HIPTSREHLAGVSDGKYFYAIGGRDLASDQNTAAVERFDPVAGTWATLPGMPTPRGGLG
FT                   ATFIDGRIVAVGGEEPTRVLSTVEAYDVVAGSWSQLPALRTPRHGMAVGAVGNTVYAVG
FT                   GGIKPTHAESTAVSEALQIAPRKTQWAPAWRPLRDAPIARQQTATAVADGTIWVFGGLD
FT                   NVGSTAKVEGNDPAIDTWKAGPDLPVPLNHAMAVEYGGELVVLGGWVPEGPNLTGKTSD
FT                   RVLALRDGNWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELVASTEVFDGTKWTTVE
FT                   DIPTSREHLAGVTDGKYFYAIGGRDLASDQNTAAVERFDPVAETWATLPGMPTPRGGLG
FT                   AAFIDGRIVAVGGEQPTRVLSTVEAYDITSGTWSALPPMPTGAHGMSVAAVGHTVYAIG
FT                   GALRPTHAESTATAQALDFW"
     MADFDPDATQ AASVRAVGHG IVAELDAAGF AGAEEVGRGG FGVVYRCLQR SLGRIVAIKV        60
     LTSDLDSENR ERFLREGYAM GGLSGHPNIV NILQVGVTET GRPYIVMHYH PRDSLAVQIR       120
     REGPLPWPEA ISIGVKLAGA LETAHRTGTL HRDIKPANIL LTDYGEPQLT DFGIAHIAGG       180
     YETATGGFTG SLAFTAPEVL NGESPTARSD VYGLGATIFS LIAGRAAFER KTGEELVAQF       240
     VRISTQTVPD LRAQGIPDGV CAVIERAMAP NPFARPASAE EFGHELQAAQ RHIGLRSDAM       300
     ALAPLEPAQP GQAHPAADAG GYRQIRFEDS DGQRRFFAST EQIQPDSHPS APFWPPTGPS       360
     PWPPPEARGR SGPARGRRRG ILIVLALVVT LVLAGGGYLV FREATGPGTA GPIAQDGGEP       420
     PAVDPTAAWR PVGDARVARQ QTATTVADGT IWVFGGLDDN GVSARQEGYD PAIDTWKAGP       480
     DLPVPLNHAM AVTYNDEPVL IGGWQAKGQN LTAVASARVM AMRDGRWVDL PPLNVPRAAG       540
     AAAVVGDRIV VAGGQADGEL VSPTEVFDGT KWTTVAHIPT SREHLAGVSD GKYFYAIGGR       600
     DLASDQNTAA VERFDPVAGT WATLPGMPTP RGGLGATFID GRIVAVGGEE PTRVLSTVEA       660
     YDVVAGSWSQ LPALRTPRHG MAVGAVGNTV YAVGGGIKPT HAESTAVSEA LQIAPRKTQW       720
     APAWRPLRDA PIARQQTATA VADGTIWVFG GLDNVGSTAK VEGNDPAIDT WKAGPDLPVP       780
     LNHAMAVEYG GELVVLGGWV PEGPNLTGKT SDRVLALRDG NWVDLPPLNV PRAAGAAAVV       840
     GDRIVVAGGQ ADGELVASTE VFDGTKWTTV EDIPTSREHL AGVTDGKYFY AIGGRDLASD       900
     QNTAAVERFD PVAETWATLP GMPTPRGGLG AAFIDGRIVA VGGEQPTRVL STVEAYDITS       960
     GTWSALPPMP TGAHGMSVAA VGHTVYAIGG ALRPTHAEST ATAQALDFW                  1009
//

If you have problems or comments...

PBIL Back to PBIL home page