(data stored in ACNUC7421 zone)

EMBL: AP011115.PE41

AP011115.PE41        Location/Qualifiers
FT   CDS             complement(34898..35314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48288"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS39"
FT                   /protein_id="BAH48288.1"
FT                   /translation="MGLRGAVDTCARVYPLGYGGEVLGDTPSGMKELEMREVDLDEFAV
FT                   RWADGVPVVDVRERWEYVDGHVPGALLMPLGQLAARTAEIPAGEVVYVICASGNRSREG
FT                   ARIVEAAGRGAVSVAGGTSGWAAHGRPLDRGDGS"
     MGLRGAVDTC ARVYPLGYGG EVLGDTPSGM KELEMREVDL DEFAVRWADG VPVVDVRERW        60
     EYVDGHVPGA LLMPLGQLAA RTAEIPAGEV VYVICASGNR SREGARIVEA AGRGAVSVAG       120
     GTSGWAAHGR PLDRGDGS                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page