(data stored in ACNUC7421 zone)

EMBL: AP011115.PE411

AP011115.PE411       Location/Qualifiers
FT   CDS             422636..423124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48658"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI1"
FT                   /protein_id="BAH48658.1"
FT                   /translation="MGMRRARWPAFAPPTASGTAVHGPTILASGTHLTLDLLGIVAFSS
FT                   GIHVRLALTATGRTAERAHHETRLLSDPADPDTQWSYLSVLLQLGSVVGVADPYLPRSG
FT                   SPRKWGGVPAYRTEPNYWLGTCTRPHDIMISAGWPEIGLGPTCLTALLEPSPSTVTSD"
     MGMRRARWPA FAPPTASGTA VHGPTILASG THLTLDLLGI VAFSSGIHVR LALTATGRTA        60
     ERAHHETRLL SDPADPDTQW SYLSVLLQLG SVVGVADPYL PRSGSPRKWG GVPAYRTEPN       120
     YWLGTCTRPH DIMISAGWPE IGLGPTCLTA LLEPSPSTVT SD                          162
//

If you have problems or comments...

PBIL Back to PBIL home page