(data stored in ACNUC7421 zone)

EMBL: AP011115.PE413

AP011115.PE413       Location/Qualifiers
FT   CDS             424683..425597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI3"
FT                   /protein_id="BAH48660.1"
FT                   /translation="MTRIRRRSAVALASIAGASVLLLAACTQDASSIDGTESAAPGATS
FT                   ESPAAEPAVDGVDAKQYASSDPATETYGFVTPSGKWLCAIIPAKQLAGCASHPTAGPLG
FT                   VPGTPQIASPNGGPPAEADLIAIEAGKEPNFQNWNQALFPGNANVLPYDTTLAVDGFSC
FT                   NVQFSGVSCREDATNKGFTVSTNGYKFEFTPLPMSVPSASPPPIAPTAAPLPQQARGSN
FT                   QCGPITYPETGKPATVVIVKGTLRCDEAHTMLTKYFTGRDKSEPVYSFDGWECRLAGDP
FT                   ESAEIGYTINCTDDNGNSVVAQP"
     MTRIRRRSAV ALASIAGASV LLLAACTQDA SSIDGTESAA PGATSESPAA EPAVDGVDAK        60
     QYASSDPATE TYGFVTPSGK WLCAIIPAKQ LAGCASHPTA GPLGVPGTPQ IASPNGGPPA       120
     EADLIAIEAG KEPNFQNWNQ ALFPGNANVL PYDTTLAVDG FSCNVQFSGV SCREDATNKG       180
     FTVSTNGYKF EFTPLPMSVP SASPPPIAPT AAPLPQQARG SNQCGPITYP ETGKPATVVI       240
     VKGTLRCDEA HTMLTKYFTG RDKSEPVYSF DGWECRLAGD PESAEIGYTI NCTDDNGNSV       300
     VAQP                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page