(data stored in ACNUC7421 zone)

EMBL: AP011115.PE414

AP011115.PE414       Location/Qualifiers
FT   CDS             425694..426011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48661"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI4"
FT                   /protein_id="BAH48661.1"
FT                   /translation="MQPPNDQAGTWEGSWLAAMTVIKSAQRVFTPDNRPPSELIPLVEP
FT                   LSRLGDALRATPPDPEESRRRAADLVADRDLITWACRPDQPRDIRELGATLAFLSMKLT
FT                   T"
     MQPPNDQAGT WEGSWLAAMT VIKSAQRVFT PDNRPPSELI PLVEPLSRLG DALRATPPDP        60
     EESRRRAADL VADRDLITWA CRPDQPRDIR ELGATLAFLS MKLTT                       105
//

If you have problems or comments...

PBIL Back to PBIL home page