(data stored in ACNUC7421 zone)

EMBL: AP011115.PE416

AP011115.PE416       Location/Qualifiers
FT   CDS             427108..428667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48663"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI6"
FT                   /protein_id="BAH48663.1"
FT                   /translation="MRIARIRRGVASSALAVSVVLGVATSPAPAIASAETYVFDDVGST
FT                   AVPRADCGPGSLPETGMQGDVPAEDRNNGRSTQGYRCNMSLIGGLQDRGGGLLSVTYDH
FT                   CSYTSTFFPGNLLDPDTPGVQVLDVSDPAQPVLSTTLNEPAMLGGTWESLKVNKARKLL
FT                   AATAVPAAAGTGYFSVYDISDCAHPRLLNRGAGTDVTMPLPFLSHEGGFSPDGNTYWVS
FT                   GPAPGFLTAIDIRNPAEPRITWQGLHGLGGHGFGITPDGNRMYLSNLGGITVLDISAVQ
FT                   RGDPYPTVPQLATYLWTDGFFNQHSIPVTYGGKPHIFTVDETGGGGIKVFDVADPAHAD
FT                   IVQKVKLEIQLPANTAANLRSSQGGSVFSYDPHYCVVDRPSDPTALACSWESSGIRVFD
FT                   IRDLDDIREIAYYNPPAQTGKNLQLTNSPHALSSLIGVSLFDFVPLARAVFEGKADPRV
FT                   AFGPRAGMVAFGDLSADWCFSPPEFHGNQIWTSCSDNGFMALQLDESVYQAPANQDSTY
FT                   GQ"
     MRIARIRRGV ASSALAVSVV LGVATSPAPA IASAETYVFD DVGSTAVPRA DCGPGSLPET        60
     GMQGDVPAED RNNGRSTQGY RCNMSLIGGL QDRGGGLLSV TYDHCSYTST FFPGNLLDPD       120
     TPGVQVLDVS DPAQPVLSTT LNEPAMLGGT WESLKVNKAR KLLAATAVPA AAGTGYFSVY       180
     DISDCAHPRL LNRGAGTDVT MPLPFLSHEG GFSPDGNTYW VSGPAPGFLT AIDIRNPAEP       240
     RITWQGLHGL GGHGFGITPD GNRMYLSNLG GITVLDISAV QRGDPYPTVP QLATYLWTDG       300
     FFNQHSIPVT YGGKPHIFTV DETGGGGIKV FDVADPAHAD IVQKVKLEIQ LPANTAANLR       360
     SSQGGSVFSY DPHYCVVDRP SDPTALACSW ESSGIRVFDI RDLDDIREIA YYNPPAQTGK       420
     NLQLTNSPHA LSSLIGVSLF DFVPLARAVF EGKADPRVAF GPRAGMVAFG DLSADWCFSP       480
     PEFHGNQIWT SCSDNGFMAL QLDESVYQAP ANQDSTYGQ                              519
//

If you have problems or comments...

PBIL Back to PBIL home page