(data stored in ACNUC7421 zone)

EMBL: AP011115.PE417

AP011115.PE417       Location/Qualifiers
FT   CDS             428657..429310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48664"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI7"
FT                   /protein_id="BAH48664.1"
FT                   /translation="MASDTRRSRFRRPVVLLLCAVLLGAGGVAAGMWLQSAREQLVGRV
FT                   QLSPADVGFAQDMSVHHEQAVLIAQTLPRDVDPQIRVIADQIVVAQTSEIATMRGWLNL
FT                   FDEAFTTAHPMQWMHGSDHVMSEQGGAPMPGTASTSEISRLAGLRGADAEALFLQLMIR
FT                   HHQGGVEMAEAAIHAVASEPIRRVARGMIRDQSNEIAVMTALLGTRDAKPLPHP"
     MASDTRRSRF RRPVVLLLCA VLLGAGGVAA GMWLQSAREQ LVGRVQLSPA DVGFAQDMSV        60
     HHEQAVLIAQ TLPRDVDPQI RVIADQIVVA QTSEIATMRG WLNLFDEAFT TAHPMQWMHG       120
     SDHVMSEQGG APMPGTASTS EISRLAGLRG ADAEALFLQL MIRHHQGGVE MAEAAIHAVA       180
     SEPIRRVARG MIRDQSNEIA VMTALLGTRD AKPLPHP                                217
//

If you have problems or comments...

PBIL Back to PBIL home page