(data stored in ACNUC7421 zone)

EMBL: AP011115.PE418

AP011115.PE418       Location/Qualifiers
FT   CDS             complement(429421..429750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48665"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI8"
FT                   /protein_id="BAH48665.1"
FT                   /translation="MSATIRSLVIPVSDLDAAKAVYTALLGEPHTDQPYYVGYNVDGFE
FT                   VALNPGEEGGGPVAFADVEDLDAARATLLEAGATERSAPRQVAAEARVCVLADADGNPI
FT                   GLRGK"
     MSATIRSLVI PVSDLDAAKA VYTALLGEPH TDQPYYVGYN VDGFEVALNP GEEGGGPVAF        60
     ADVEDLDAAR ATLLEAGATE RSAPRQVAAE ARVCVLADAD GNPIGLRGK                   109
//

If you have problems or comments...

PBIL Back to PBIL home page