(data stored in ACNUC7421 zone)

EMBL: AP011115.PE420

AP011115.PE420       Location/Qualifiers
FT   CDS             complement(430705..431088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48667"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ0"
FT                   /protein_id="BAH48667.1"
FT                   /translation="MMTPPDEYVSVRYLVDDVAAAIDFYTSHLGFTLHTNPAPAFADVT
FT                   RGSLTLLLSGPASSGARATPADNAGAGRNRIHLIVGDLDDEVTRLRDAGVTFRSDVVVG
FT                   PGGRQILLADPSGNLVELFQPAT"
     MMTPPDEYVS VRYLVDDVAA AIDFYTSHLG FTLHTNPAPA FADVTRGSLT LLLSGPASSG        60
     ARATPADNAG AGRNRIHLIV GDLDDEVTRL RDAGVTFRSD VVVGPGGRQI LLADPSGNLV       120
     ELFQPAT                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page