(data stored in ACNUC7421 zone)

EMBL: AP011115.PE421

AP011115.PE421       Location/Qualifiers
FT   CDS             complement(431396..431770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48668"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ1"
FT                   /protein_id="BAH48668.1"
FT                   /translation="MEWSVARVAGDDRDTAGPSAAADRGSSGSGYRPSLESAPNPTPRR
FT                   AVRQLRCLRLRSHRRSTFCDRRSRYRGARTLYCPPNEEHWHGAGTDSFMEHLAMLDNAD
FT                   DPATTTTWLEHVTDDEYLAE"
     MEWSVARVAG DDRDTAGPSA AADRGSSGSG YRPSLESAPN PTPRRAVRQL RCLRLRSHRR        60
     STFCDRRSRY RGARTLYCPP NEEHWHGAGT DSFMEHLAML DNADDPATTT TWLEHVTDDE       120
     YLAE                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page