(data stored in ACNUC7421 zone)

EMBL: AP011115.PE423

AP011115.PE423       Location/Qualifiers
FT   CDS             complement(433001..433489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04230"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48670"
FT                   /db_xref="GOA:C1ARJ3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ3"
FT                   /protein_id="BAH48670.1"
FT                   /translation="MGDRIPPPLDNLLEGNIMTSVNLSKQHPSVYKSLMKLDADVKAAL
FT                   ETAGVDPLLVELVKIRVSQLNGCAFCLRMHTRDALAKGETTDRLAVVAAWWEAQYFSEK
FT                   ERAALALAEQVTALSVPERRAWDDGSLTDEQVSAISWLATVMNAWNRVAVTSHYPVTP"
     MGDRIPPPLD NLLEGNIMTS VNLSKQHPSV YKSLMKLDAD VKAALETAGV DPLLVELVKI        60
     RVSQLNGCAF CLRMHTRDAL AKGETTDRLA VVAAWWEAQY FSEKERAALA LAEQVTALSV       120
     PERRAWDDGS LTDEQVSAIS WLATVMNAWN RVAVTSHYPV TP                          162
//

If you have problems or comments...

PBIL Back to PBIL home page