(data stored in ACNUC7421 zone)

EMBL: AP011115.PE427

AP011115.PE427       Location/Qualifiers
FT   CDS             436411..437697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48674"
FT                   /db_xref="GOA:C1ARJ7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR040570"
FT                   /db_xref="InterPro:IPR041472"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ7"
FT                   /protein_id="BAH48674.1"
FT                   /translation="MAHLLLVESWVGAMGTLLPRAVAELGAEFTFLTRRPEHYPQSAPD
FT                   GLPHPLRLGRGVVTAETNDPATALAAARTLHADTPIDGVLTSCDYYLPLAARIAAELGL
FT                   PGPTPAAVVAACNKALTRAALDRCDVPGPRHVTVPADDQQRLRTGAEMVGFPLVLKPTD
FT                   LCAGMFVRRVEDWAALDTAARDLLRFEVNARGQRREPVVLLEEFLEGPEFSVESWIRDG
FT                   EVHTVGVTDKSLGGASGFVETGHMFPADVGDQDHARLVAAAEAAIRAVGLDHGVVHTEL
FT                   RLTAAGPRIIEINPRPAGNQITELIRHVTGIDLPRIAVELALGREPALPTVPNGQRGGS
FT                   RALSAAVSMLVPARAGILTGIEGTEAVAADPAVIAATFKAPGHRTTVGVDNNSYLGSVI
FT                   ALSHEQSGARRLAEGLLSAVSARYEEPAP"
     MAHLLLVESW VGAMGTLLPR AVAELGAEFT FLTRRPEHYP QSAPDGLPHP LRLGRGVVTA        60
     ETNDPATALA AARTLHADTP IDGVLTSCDY YLPLAARIAA ELGLPGPTPA AVVAACNKAL       120
     TRAALDRCDV PGPRHVTVPA DDQQRLRTGA EMVGFPLVLK PTDLCAGMFV RRVEDWAALD       180
     TAARDLLRFE VNARGQRREP VVLLEEFLEG PEFSVESWIR DGEVHTVGVT DKSLGGASGF       240
     VETGHMFPAD VGDQDHARLV AAAEAAIRAV GLDHGVVHTE LRLTAAGPRI IEINPRPAGN       300
     QITELIRHVT GIDLPRIAVE LALGREPALP TVPNGQRGGS RALSAAVSML VPARAGILTG       360
     IEGTEAVAAD PAVIAATFKA PGHRTTVGVD NNSYLGSVIA LSHEQSGARR LAEGLLSAVS       420
     ARYEEPAP                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page