(data stored in ACNUC7421 zone)

EMBL: AP011115.PE433

AP011115.PE433       Location/Qualifiers
FT   CDS             442783..444360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04330"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48680"
FT                   /db_xref="GOA:C1ARK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK3"
FT                   /protein_id="BAH48680.1"
FT                   /translation="MNPVPRSPLSPLPYLSRRSFLGLGAAATGAVLIGACSTGDTGTQV
FT                   TSTPRDGGRLRAVFAGGGAQEVLDPHKTNLYADVARSNALYDKLVEYGDDLGPVPRLAT
FT                   AWRPNADATTWTVQLRPAVFHDGRPVRAADVLYSYQRILDPKNALRPRASLEVIDIARS
FT                   RQVDDRSIEFVCTRPCGDLANVLAAFGAYIIPEGTTDFTAPIGSGPFTFVSFAPGRSFV
FT                   AARFGDYWDGPPHVEQLEILTAPDETARINALLGGQVEYADDLGVTSARTYETDARVQI
FT                   LRSPRSAMSGFAMKVDRPPFDNLDLRRAMFALTDRDELVSTVLGSTGVVGNDLFGKDTK
FT                   YYATDLPQRSLDLDDAKTLIRKAGAQNTTIELQTTGATNGFVEAANILAEQAARAGLTI
FT                   DVKVGEGSTYWTRTLDEGVLSSFRSGAMPIETHLAQRMLSTSSKNYTQWRRPDFDALFA
FT                   TASETTDEAVRARAYRDMQSQLYTEGGLLVWGFSDGLHGLAPNLAGMARSAPSNTLGYA
FT                   RFDKAWLS"
     MNPVPRSPLS PLPYLSRRSF LGLGAAATGA VLIGACSTGD TGTQVTSTPR DGGRLRAVFA        60
     GGGAQEVLDP HKTNLYADVA RSNALYDKLV EYGDDLGPVP RLATAWRPNA DATTWTVQLR       120
     PAVFHDGRPV RAADVLYSYQ RILDPKNALR PRASLEVIDI ARSRQVDDRS IEFVCTRPCG       180
     DLANVLAAFG AYIIPEGTTD FTAPIGSGPF TFVSFAPGRS FVAARFGDYW DGPPHVEQLE       240
     ILTAPDETAR INALLGGQVE YADDLGVTSA RTYETDARVQ ILRSPRSAMS GFAMKVDRPP       300
     FDNLDLRRAM FALTDRDELV STVLGSTGVV GNDLFGKDTK YYATDLPQRS LDLDDAKTLI       360
     RKAGAQNTTI ELQTTGATNG FVEAANILAE QAARAGLTID VKVGEGSTYW TRTLDEGVLS       420
     SFRSGAMPIE THLAQRMLST SSKNYTQWRR PDFDALFATA SETTDEAVRA RAYRDMQSQL       480
     YTEGGLLVWG FSDGLHGLAP NLAGMARSAP SNTLGYARFD KAWLS                       525
//

If you have problems or comments...

PBIL Back to PBIL home page