(data stored in ACNUC7421 zone)

EMBL: AP011115.PE434

AP011115.PE434       Location/Qualifiers
FT   CDS             444357..445307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04340"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48681"
FT                   /db_xref="GOA:C1ARK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK4"
FT                   /protein_id="BAH48681.1"
FT                   /translation="MILTRYAGMRVALGLAQVLGVLVVVFLVASVLPGDAAVVIAADDA
FT                   DPARIAQLRETLGLDRPLLVQLGDWLAGLPRADLGTSAVSGRPVAEILSAALVPTLTLA
FT                   ALALAVLIPLAVGLGVAAAVGRGRRVDRTISGVVVALYAVPEFALAIVLVAVFAVGLGL
FT                   FAPTAVGAGGPLLWQPELWVLPVAVLVIRPVCSLSRLVRASMITTLESDYIRHTLRLGV
FT                   PGRRVVWRHALPGSLTPAAAHLARVADWLLGGVVVVEAVFALGGLGQVLVSAVSSRDIP
FT                   LLMGLAALFAVITVAVNTIADIVAFRLTPTAGGTS"
     MILTRYAGMR VALGLAQVLG VLVVVFLVAS VLPGDAAVVI AADDADPARI AQLRETLGLD        60
     RPLLVQLGDW LAGLPRADLG TSAVSGRPVA EILSAALVPT LTLAALALAV LIPLAVGLGV       120
     AAAVGRGRRV DRTISGVVVA LYAVPEFALA IVLVAVFAVG LGLFAPTAVG AGGPLLWQPE       180
     LWVLPVAVLV IRPVCSLSRL VRASMITTLE SDYIRHTLRL GVPGRRVVWR HALPGSLTPA       240
     AAHLARVADW LLGGVVVVEA VFALGGLGQV LVSAVSSRDI PLLMGLAALF AVITVAVNTI       300
     ADIVAFRLTP TAGGTS                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page