(data stored in ACNUC7421 zone)

EMBL: AP011115.PE439

AP011115.PE439       Location/Qualifiers
FT   CDS             450281..450436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48686"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK9"
FT                   /protein_id="BAH48686.1"
FT                   /translation="MHRLDLSGARLDPSDSRQFAAAAAIELEAGRRDPYRQLSRIFHLV
FT                   GRKGPN"
     MHRLDLSGAR LDPSDSRQFA AAAAIELEAG RRDPYRQLSR IFHLVGRKGP N                 51
//

If you have problems or comments...

PBIL Back to PBIL home page