(data stored in ACNUC7421 zone)

EMBL: AP011115.PE44

AP011115.PE44        Location/Qualifiers
FT   CDS             complement(36522..37019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48291"
FT                   /db_xref="GOA:C1AS42"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS42"
FT                   /protein_id="BAH48291.1"
FT                   /translation="MSGAGNRLITPMLATPGEPPVEMDGWAAEMKYDGFRLLAGVGGAH
FT                   PVLWTRNLNVVTSSYPEVTEALTEAFGGHGRIVFDGEIVALTQGRPSFARLQKRANTLR
FT                   PTTTLRRQVPVTFLPFDVLYRTSELGHPRLVWLLLRDAHFRCASADSGLLDVDWRVPGV
FT                   NG"
     MSGAGNRLIT PMLATPGEPP VEMDGWAAEM KYDGFRLLAG VGGAHPVLWT RNLNVVTSSY        60
     PEVTEALTEA FGGHGRIVFD GEIVALTQGR PSFARLQKRA NTLRPTTTLR RQVPVTFLPF       120
     DVLYRTSELG HPRLVWLLLR DAHFRCASAD SGLLDVDWRV PGVNG                       165
//

If you have problems or comments...

PBIL Back to PBIL home page