(data stored in ACNUC7421 zone)

EMBL: AP011115.PE440

AP011115.PE440       Location/Qualifiers
FT   CDS             450482..451993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04400"
FT                   /product="drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48687"
FT                   /db_xref="GOA:C1ARL0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL0"
FT                   /protein_id="BAH48687.1"
FT                   /translation="MRSERSASLGVFMKTASPRTHYQLTFTVLTIGVGAFALLQSLLMP
FT                   VLPTLESALGTTQADVTWVLTAYLLSASIFTPVMGRLGDMHGKKRVFVLALAALAVGSL
FT                   LAALATSLPVMIAARAIQGIGGGVLPLAFGIIRDEFPEEKVAGAVGVIAALTAVGAGLG
FT                   IVLAGPIVTVLSYHWLFWIPLIMVVLAGAAAQMLIPESPVRTAGKINWLTALLLSGWLV
FT                   TLLLGVSQAPAWGWGSPIVVGLLVAAAVIVVTWVAAEARSSNPLIDMQMMRVRSVWAAN
FT                   LLALLMGVGMYAAFGFLPQFLQTPTAAGYGFGASVTESGLMLLPLSVGMFLLGLASGRL
FT                   AARLGSKCLLIAGSVVSAIGYFVVAFAHQTETEIYLATSLIGIGFGLAFSAMSNVVVAA
FT                   VPSEQTGVASGMNANIRTIGGSLGAALMASIVTAGASAEGVPPESGYTHGFVVLGTAVG
FT                   LGAVAAMFIPAMKRGDITRLEESTALRHPELAMVAGGTLVGDEPE"
     MRSERSASLG VFMKTASPRT HYQLTFTVLT IGVGAFALLQ SLLMPVLPTL ESALGTTQAD        60
     VTWVLTAYLL SASIFTPVMG RLGDMHGKKR VFVLALAALA VGSLLAALAT SLPVMIAARA       120
     IQGIGGGVLP LAFGIIRDEF PEEKVAGAVG VIAALTAVGA GLGIVLAGPI VTVLSYHWLF       180
     WIPLIMVVLA GAAAQMLIPE SPVRTAGKIN WLTALLLSGW LVTLLLGVSQ APAWGWGSPI       240
     VVGLLVAAAV IVVTWVAAEA RSSNPLIDMQ MMRVRSVWAA NLLALLMGVG MYAAFGFLPQ       300
     FLQTPTAAGY GFGASVTESG LMLLPLSVGM FLLGLASGRL AARLGSKCLL IAGSVVSAIG       360
     YFVVAFAHQT ETEIYLATSL IGIGFGLAFS AMSNVVVAAV PSEQTGVASG MNANIRTIGG       420
     SLGAALMASI VTAGASAEGV PPESGYTHGF VVLGTAVGLG AVAAMFIPAM KRGDITRLEE       480
     STALRHPELA MVAGGTLVGD EPE                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page